PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676717430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family G2-like
Protein Properties Length: 348aa    MW: 39053.5 Da    PI: 8.1731
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676717430genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.6e-32214269156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rF++a++qLGGs++AtPk+i+ lmkv+gLt+++vkSHLQkYRl+
  676717430 214 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRYLMKVDGLTNDEVKSHLQKYRLH 269
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.626211271IPR017930Myb domain
SuperFamilySSF466893.29E-17212272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27212272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-26214269IPR006447Myb domain, plants
PfamPF002497.8E-7216267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAKNGDMDST LKMQRCQEYV EALEQEQKKI QVFQRELPLC LELVTQAIQS CRKELSGYST  60
SEHAHGQSEC SERTTSECGG GGGTAAQVPF EEFMPIKWSS SSSDEHESCE LDKEENNGDK  120
KKSDWLRSVQ LWNQSPDTQP KEDQTATVVV KEVKRSCGAF QPFQKEKPVV ASKADSQPLK  180
AITTTPTTSS STEETVGNKR ESEEQKQSRL HHRKQRRCWS PELHRRFLHA LQQLGGSHVA  240
TPKQIRYLMK VDGLTNDEVK SHLQKYRLHT RRPTTSAVNN GGENPQQAQF MVVEGIWVPS  300
HDAANNRVYA PVAVQPPQRS SPSEQSSSRR CKSPTSSSTH TAHLLPLS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415885.11e-170hypothetical protein EUTSA_v10008115mg
TrEMBLV4L3B61e-170V4L3B6_EUTSA; Uncharacterized protein
STRINGAT1G25550.11e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-151G2-like family protein